On 02/10/2012 07:35 AM, intekhab alam wrote:
> Hi all
> I have a 3A dataset for a protein-protein complex. I have successfully
> build the first protein and refined it to R/Rfree 24/28. I can see some
> density for my second protein but the density is a bit noisy. I have
> attached the coot image of the density. I want to model the aminoacid
> having sequence as given
> peptide:
> MGKKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLE
>
> 1.Based on map features which segemnt should i start with.
> 2. Is there anyway that i can build the best fit segment of my second
> protein.
>
> I tried autobuild but it failed to build any peptide for my second protein.
>
> Your help is highly appreciated.
>
> regards
Try buccaneer - it should work very easily with that density..
Eleanor
|