On 02/18/2011 07:42 AM, Vellieux Frederic wrote:
Arp Warp used to want a blank line between the > MALDH title, and the
first line of the sequence..
Not sure if that still holds.
Eleanor
a> Hi Careina,
>
> Just an example of a pir file which I just generated (using Bart Hazes
> program mcfman):
>
> P1;>MALDH_
> Just a title
> TKVSVVGAAGTVGAAAGYNIALDIADEVVFVDIPDKEDDTVGQAADTNHGIAYDSNTRVR
> QGGYEDTAGSDVVVITAGIPRQPGQTRIDLAGDNAPIMEDIQSSLDEHNDDYISLTTSNP
> VDLLNRHLYEAGDRSREQVIGFGGRLDSARFRYVLSEEFDAPVQNVEGTILGEHGDAQVP
> VFSKVSVDGTDPEFSGDEKEQLLGDLQESAMDVIERKGATEWGPARGVAHMVEAILHDTG
> EVLPASVKLEGEFGHEDTAFGVPVSLGSNGVEEIVEWDLDDYEQDLMADAAEKLSDQYDK
> IS*
>
> I don't think the pir format has changed much since the subroutine that
> extracts the sequence from a coordinate file was written. As you will
> see the (ASCII) format is pretty simple, one start record, one title
> record followed by records containing the sequence in the one-character
> abbreviation, 60 characters per line, with "*" to end the sequence. The
> start record is P1;> followed by 6 characters.
>
> I never had any problems with the pir files generated by mcfman, and I
> always have used an editor (vi is the one I use) to convert other
> formats to this format.
>
> Fred.
>
> Careina Edgooms wrote:
>> Dear CCP4 mailing list
>>
>> I have a relatively simple question. How do I get sequence file in
>> .pir format which is required for many programs? I normally use fasta
>> format but some programs eg arpwarp do not allow me to use that
>>
>> Thanks for your help
>>
>> Careina
>>
|